PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c26_700V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YC
Protein Properties Length: 139aa    MW: 15412.2 Da    PI: 5.9669
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c26_700V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC28.72.8e-09521071469
             NF-YC  14 tdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeen 69 
                       +++   ++P++r++++ k++ d++ +  ea  l++ka elf+ +l   ++ + ++n
  Pp3c26_700V3.2.p  52 QNLLTLSFPISRVRRLAKSEGDIQWVGVEAGFLIAKATELFLEKLVEDAFGRMRDN 107
                       5666789**********************************988877666666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.0E-1356117IPR009072Histone-fold
SuperFamilySSF471134.19E-1158119IPR009072Histone-fold
PfamPF008084.3E-658109IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MSTTNSESEV QRSYEDDERK ENGYSYEENG NKSENGTPAS WRASGKPGKS LQNLLTLSFP  60
ISRVRRLAKS EGDIQWVGVE AGFLIAKATE LFLEKLVEDA FGRMRDNRQA SILYPHLYIV  120
PVRIPAATAL QNASMADK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001782404.13e-61predicted protein
TrEMBLA9TUW33e-61A9TUW3_PHYPA; Predicted protein
STRINGPP1S149_89V6.12e-81(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP86701112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-10nuclear factor Y, subunit C10